Rab11Protein[10126][10µg]CatalogNumber:10126ProductName:Rab11ProteinSynonyms:Rab-protein11,CG5771,DmRab11,Drab11,Rab-r11,RAB11Source:Human,recombinantfulllength,His6-tagExpressionHost:E

詳細介紹

Rab11 Protein [10126]
[10 µg]

Catalog Number: 10126

Product Name: Rab11 Protein

Synonyms: Rab-protein 11, CG5771, DmRab11, Drab11, Rab-r11, RAB11

Source: Human, recombinant full length, His6-tag

Expression Host: E. coli

Molecular Weight: 18 kDa

Purity: >95% by SDS-PAGE

Introduction: Rab11 is a small GTP-binding proteins of the Rab family, such as Rab11A, play essential roles in vesicle and granule targeting. Rab11 is also a GTPase that regulates endosomal trafficking to apical plasma membrane domains in polarized epithelial cells.

Amino Acid Sequence (1-173)

MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDT
AGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAV
PTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab11 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining.

References:
1. Bao, X. et al., Europ. J. Biochem. 269: 259-271, 2002.
2. Gromov, P. S. et al., FEBS Lett. 429: 359-364, 1998.
3. Casanova, J. E. et al., Molec. Biol. Cell 10: 47-61, 1999.
4. Drivas, G. T. et al., Oncogene 6: 3-9, 1991.
5. Gromov, P. S. et al., FEBS Lett. 429: 359-364, 1998.
6. Guichard, A. et al., Nature 467: 854-858, 2010.
7. Larance, M. et al., J. Biol. Chem. 280: 37803-37813, 2005.
8. Shirane, M. et al., Science 314: 818-821, 2006.

Datasheet:

Related Products
Catalog#	Name	Size	Price
	Active Rab11-GTP Monoclonal Antibody	30 μL	￥4800
	Rab11 Activation Assay Kit	20 assays	￥6800
	Anti-Rab11 Mouse Monoclonal Antibody	100 μL	￥2800