Arl1ProteinQ71Lmutant[10156][25µg]CatalogNumber:10156ProductName:Arl1ProteinQ71LmutantSynonyms:ADP-ribosylationfactor-like1,ARFL1Source:Human,recombinantfulllength,His6-tagExpressionHost:E

詳細介紹

Arl1 Protein Q71L mutant [10156]
[25 µg]

Catalog Number: 10156

Product Name: Arl1 Protein Q71L mutant

Synonyms: ADP-ribosylation factor-like 1, ARFL1

Source: Human, recombinant full length, His6-tag

Expression Host: E. coli

Molecular Weight: 20 kDa

Purity: >95% by SDS-PAGE

Introduction: Arl1 is a member of the Arf family of regulatory GTPases, within the Ras superfamily of GTPases (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform.

Amino Acid Sequence (1-181, Q71L)

MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWD
LGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAM
TSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ

Properties

Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl.

Physical Appearance (form): White or clear

Concentration: 1 mg/mL

Storage: -80°C

Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Arl1 Q71L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining

References:
1. Hong, J.-X. et al., J. Biol. Chem. 273: 15872-15876, 1998.
2. Zhang, G.-F. et al., J. Biol. Chem. 270: 21-24, 1995.

Datasheet:

Related Products
Catalog#	Name	Size	Price
	Active Arl1-GTP Monoclonal Antibody	30 μL	￥4800
	Arl1 Activation Assay Kit	20 assay	￥6800
	Anti-Arl1 Mouse Monoclonal Antibody	100 μL	￥2800